Search results

Search for "binding affinity" in Full Text gives 212 result(s) in Beilstein Journal of Organic Chemistry. Showing first 200.

Photocontrolled DNA minor groove interactions of imidazole/pyrrole polyamides

  • Sabrina Müller,
  • Jannik Paulus,
  • Jochen Mattay,
  • Heiko Ihmels,
  • Veronica I. Dodero and
  • Norbert Sewald

Beilstein J. Org. Chem. 2020, 16, 60–70, doi:10.3762/bjoc.16.8

Graphical Abstract
  • % P1; 67% P2; after 1 d: 76% P3). Analysis of polyamide–DNA interaction by induced circular dichroism CD spectroscopic analysis is suitable for the characterization of DNA minor groove binders, providing semiquantitative information about binding affinity and thermal stability of the target dsDNA [47
  • hyperchromicity of the signal on increasing PA concentration and the spectral behavior observed were characteristic for a B-DNA structure [51][53]. In contrast, Z-P2 did not reach saturation in the tested concentration range (Figure 3B), which is indicative of a lower binding affinity in comparison with the other
  • saturation with the single-point mutation DNA D3’ at the tested concentration range, suggesting lower binding affinity compared to target dsDNA D3. The maxima of the ICD signals at 325 and 333 nm were plotted against the concentration of polyamide to quantify the binding of the PA to the cognate dsDNA. The
PDF
Album
Supp Info
Full Research Paper
Published 09 Jan 2020

Photoreversible stretching of a BAPTA chelator marshalling Ca2+-binding in aqueous media

  • Aurélien Ducrot,
  • Arnaud Tron,
  • Robin Bofinger,
  • Ingrid Sanz Beguer,
  • Jean-Luc Pozzo and
  • Nathan D. McClenaghan

Beilstein J. Org. Chem. 2019, 15, 2801–2811, doi:10.3762/bjoc.15.273

Graphical Abstract
  • -withdrawing carbonyl function is generated from a secondary alcohol adjacent to the BAPTA binding site upon photoirradiation, which proved sufficient to lower the binding affinity 40-fold and liberate calcium in biological media [17]. This design was subsequently improved in a symmetrical variant and indeed a
  • calcium sufficiently well and show sufficient photoactivity in this situation. However, the modest 2.5-fold difference of binding affinity between complexing and non-complexing forms, while comparable to the best-known photochromic variants [25][26], would need to be significantly increased (at least by
  • switching in terms of quantum yields (0.08) and PSS composition (88% cis). The calcium binding affinity of the cis-form was diminished by circa 2.5-fold with respect to the trans-form as the chelator was stretched rendering the binding pocket ill-adapted to accommodate the calcium, as suggested by molecular
PDF
Album
Supp Info
Full Research Paper
Published 21 Nov 2019

A chiral self-sorting photoresponsive coordination cage based on overcrowded alkenes

  • Constantin Stuckhardt,
  • Diederik Roke,
  • Wojciech Danowski,
  • Edwin Otten,
  • Sander J. Wezenberg and
  • Ben L. Feringa

Beilstein J. Org. Chem. 2019, 15, 2767–2773, doi:10.3762/bjoc.15.268

Graphical Abstract
  • considered to translate these geometrical changes to changes in properties such as guest binding affinity and selectivity. Schematic representation of a photoresponsive cage with ligands based on overcrowded alkenes. Aromatic region of stacked 1H NMR spectra (in CD3CN) of stable Z-1 and cage complex Pd2
PDF
Album
Supp Info
Full Research Paper
Published 15 Nov 2019

A toolbox of molecular photoswitches to modulate the CXCR3 chemokine receptor with light

  • Xavier Gómez-Santacana,
  • Sabrina M. de Munnik,
  • Tamara A. M. Mocking,
  • Niels J. Hauwert,
  • Shanliang Sun,
  • Prashanna Vijayachandran,
  • Iwan J. P. de Esch,
  • Henry F. Vischer,
  • Maikel Wijtmans and
  • Rob Leurs

Beilstein J. Org. Chem. 2019, 15, 2509–2523, doi:10.3762/bjoc.15.244

Graphical Abstract
  • the binding affinity for the target protein [3][4][5] or the intrinsic functional activity (efficacy) [6][7]. Despite the considerable number of photoswitches reported to date, such as spiropyrans, diarylethenes, fulgides or azobenzenes, the most widely used moiety in the photopharmacology is the
  • ligands [10]. The ensuing photochromic GPCR ligands are usually orthosteric and the photoswitching generally affects the functional potency [4][11][23] and/or the binding affinity [3][4][5][11] of the ligand (Figure 1A). However, as mentioned, GPCRs that endogenously bind large molecules (large peptides
  • notably 4g deviate from this trend, since the percentage of cis-isomer in the PSS is significantly lower (58–80%). Trans-4a–i show a slight decrease in binding affinity compared to the subseries 2 and 3, amounting to low micromolar values (Table 2). Moreover, PSS affinity values are also modest, with only
PDF
Album
Supp Info
Full Research Paper
Published 23 Oct 2019

In search of visible-light photoresponsive peptide nucleic acids (PNAs) for reversible control of DNA hybridization

  • Lei Zhang,
  • Greta Linden and
  • Olalla Vázquez

Beilstein J. Org. Chem. 2019, 15, 2500–2508, doi:10.3762/bjoc.15.243

Graphical Abstract
  • , even at 90 °C. Both melting experiments and strand displacement assays demonstrated that mismatches had a dramatic effect on the binding affinity of the PNA, which was slightly compensated by the incorporation of oF4Azo. We observed modest, yet clear, differences in the formation of PNA/DNA duplexes
PDF
Album
Supp Info
Letter
Published 22 Oct 2019

1,2,3-Triazolium macrocycles in supramolecular chemistry

  • Mastaneh Safarnejad Shad,
  • Pulikkal Veettil Santhini and
  • Wim Dehaen

Beilstein J. Org. Chem. 2019, 15, 2142–2155, doi:10.3762/bjoc.15.211

Graphical Abstract
  • association constant of macrocycle 3 in the more competitive 15% water/acetone medium, still demonstrating a high binding affinity for sulfate anion (Ka = 2.5 × 105 M−1) while the cage 3 did not show any binding toward the other tested anions in the more aqueous solvent mixture. 2.3. Redox-active 1,2,3
  • to be very difficult to further proceed. However, the anion binding property of the corresponding bistriazolium macrocyclic part 5·(BF4)2 (Figure 5) has successfully been investigated using 1H NMR titration experiments in CD3CN. The highest binding affinity was found to be almost similar for both BzO
  • an active metal template strategy. The 1H NMR binding data of 8·Se were studied in organic and aqueous solvent mixtures, revealing that ChB–anion binding affinity can compete with and even outperform hydrogen bonding receptor analogues. Due to the larger degree of covalency with the heavier halides
PDF
Album
Review
Published 12 Sep 2019

Archangelolide: A sesquiterpene lactone with immunobiological potential from Laserpitium archangelica

  • Silvie Rimpelová,
  • Michal Jurášek,
  • Lucie Peterková,
  • Jiří Bejček,
  • Vojtěch Spiwok,
  • Miloš Majdl,
  • Michal Jirásko,
  • Miloš Buděšínský,
  • Juraj Harmatha,
  • Eva Kmoníčková,
  • Pavel Drašar and
  • Tomáš Ruml

Beilstein J. Org. Chem. 2019, 15, 1933–1944, doi:10.3762/bjoc.15.189

Graphical Abstract
  • thapsigargin and its derivatives contributing to SERCA binding affinity (according to [22]): A) octanoyl, B) butanoyl or 2-methylbutanoyl, C) acetyl, D) angeloyl. Viability of rat peritoneal cells treated with archangelolide (1), dansylarchangelolide 5 and dansyl amide itself. Compounds were applied at 4 µM
PDF
Album
Supp Info
Full Research Paper
Published 13 Aug 2019

Complexation of 2,6-helic[6]arene and its derivatives with 1,1′-dimethyl-4,4′-bipyridinium salts and protonated 4,4'-bipyridinium salts: an acid–base controllable complexation

  • Jing Li,
  • Qiang Shi,
  • Ying Han and
  • Chuan-Feng Chen

Beilstein J. Org. Chem. 2019, 15, 1795–1804, doi:10.3762/bjoc.15.173

Graphical Abstract
  • smaller than that of H1·G1, but much higher than that of H2·G1. In the case of H3 containing n-butoxy groups, almost no binding affinity toward G1 was observed under these conditions. Compared with G1, the protonated 4,4'-bipyridinium salt G3 showed similar complexation behavior but significantly lower
PDF
Album
Supp Info
Full Research Paper
Published 26 Jul 2019

2,3-Dibutoxynaphthalene-based tetralactam macrocycles for recognizing precious metal chloride complexes

  • Li-Li Wang,
  • Yi-Kuan Tu,
  • Huan Yao and
  • Wei Jiang

Beilstein J. Org. Chem. 2019, 15, 1460–1467, doi:10.3762/bjoc.15.146

Graphical Abstract
  • rather wide guest scope. Therefore, we wondered whether multiple conformations would be observed by incorporating the 2,3-dialkoxynaphthalene units into tetralactam macrocycles as the sidewalls. How would this affect their binding affinity and selectivity of the resulting macrocycles? Herein, we describe
  • isophthalamide bridging units bind these complexes with decent binding affinities. This macrocycle shows similar binding affinity to chloride, weaker affinity to the chloride complex of gold(III), and much stronger affinities to the chloride complexes of platinum(II) and palladium(II), when compared to the
  • between the amide NH protons and the pyridine nitrogen atoms in 2, which pre-organizes the cavity for molecular recognition. How would this affect the binding affinity of 2? To answer this question, molecular modelling was performed. Only conformer I of 1 was used for the molecular modelling but both
PDF
Album
Supp Info
Full Research Paper
Published 02 Jul 2019

Complexation of a guanidinium-modified calixarene with diverse dyes and investigation of the corresponding photophysical response

  • Yu-Ying Wang,
  • Yong Kong,
  • Zhe Zheng,
  • Wen-Chao Geng,
  • Zi-Yi Zhao,
  • Hongwei Sun and
  • Dong-Sheng Guo

Beilstein J. Org. Chem. 2019, 15, 1394–1406, doi:10.3762/bjoc.15.139

Graphical Abstract
  • with carboxylated bipyridyl ligands (Ru(dcbpy)3), were screened as model guests on account of the desired strong host–guest binding affinity (Scheme 2). Fl, EY, RB, TPPS and AlPcS4 were employed as classical aggregation-caused quenching (ACQ) dyes; 2,6-TNS and 1,8-ANS were selected as intramolecular
  • activation (BDA) [27]. In that work, we employed the four PSs and studied their host–guest complexation with GC5A. Each PS has a strong binding affinity upon 1:1 complexation with GC5A (Table 1), accompanied by a drastic annihilation of both fluorescence and photoactivity (reactive oxygen species generation
PDF
Album
Full Research Paper
Published 25 Jun 2019

Bambusuril analogs based on alternating glycoluril and xylylene units

  • Tomáš Lízal and
  • Vladimír Šindelář

Beilstein J. Org. Chem. 2019, 15, 1268–1274, doi:10.3762/bjoc.15.124

Graphical Abstract
  • bind inorganic anions with high binding affinity and selectivity in both organic media and water [13][14]. Previously we used bambusurils to recognize and quantify anions in their complex mixtures at sub-micromolar concentrations by means of NMR [15]. However, sensing of anions by less expensive UV–vis
PDF
Album
Supp Info
Letter
Published 11 Jun 2019

Diaminoterephthalate–α-lipoic acid conjugates with fluorinated residues

  • Leon Buschbeck,
  • Aleksandra Markovic,
  • Gunther Wittstock and
  • Jens Christoffers

Beilstein J. Org. Chem. 2019, 15, 981–991, doi:10.3762/bjoc.15.96

Graphical Abstract
  • , target compound 3 has the highest (0.57), target compound 7 the lowest (0.04) quantum yield. XPS characterization of SAMs. SAMs were prepared from compounds 3 and 7 exploiting the strong binding affinity of the ALA residue to gold surfaces [52]. The resulting layers of compound 3 (SAM 3) and 7 (SAM 7
PDF
Album
Supp Info
Full Research Paper
Published 26 Apr 2019

Design of indole- and MCR-based macrocycles as p53-MDM2 antagonists

  • Constantinos G. Neochoritis,
  • Maryam Kazemi Miraki,
  • Eman M. M. Abdelraheem,
  • Ewa Surmiak,
  • Tryfon Zarganes-Tzitzikas,
  • Beata Łabuzek,
  • Tad A. Holak and
  • Alexander Dömling

Beilstein J. Org. Chem. 2019, 15, 513–520, doi:10.3762/bjoc.15.45

Graphical Abstract
  • size of 15–17 atoms and an oxygen as the heteroatom linker improves the binding affinity. All the active macrocycles have a 6-chloro-substituted indole core. It is well established that at the bottom of the Try23 pocket a hydrophobic small subpocket exists which is formed by Phe86, Ile103, Leu82 and
PDF
Album
Supp Info
Full Research Paper
Published 20 Feb 2019

Study on the regioselectivity of the N-ethylation reaction of N-benzyl-4-oxo-1,4-dihydroquinoline-3-carboxamide

  • Pedro N. Batalha,
  • Luana da S. M. Forezi,
  • Maria Clara R. Freitas,
  • Nathalia M. de C. Tolentino,
  • Ednilsom Orestes,
  • José Walkimar de M. Carneiro,
  • Fernanda da C. S. Boechat and
  • Maria Cecília B. V. de Souza

Beilstein J. Org. Chem. 2019, 15, 388–400, doi:10.3762/bjoc.15.35

Graphical Abstract
  • eigenvalue in the Hessian second order matrix) [28][38][39][40][41]. Structures of some bioactive 4-oxoquinoline-3-carboxamide derivatives 1–4 with different bioactive profiles. Ki = binding affinity; AHA = acetohydroxamic acid (standard urease inhibitor); SAHA = suberoylanilide hydroxamic acid (an FDA
PDF
Album
Supp Info
Full Research Paper
Published 12 Feb 2019

Synthesis of a tubugi-1-toxin conjugate by a modulizable disulfide linker system with a neuropeptide Y analogue showing selectivity for hY1R-overexpressing tumor cells

  • Rainer Kufka,
  • Robert Rennert,
  • Goran N. Kaluđerović,
  • Lutz Weber,
  • Wolfgang Richter and
  • Ludger A. Wessjohann

Beilstein J. Org. Chem. 2019, 15, 96–105, doi:10.3762/bjoc.15.11

Graphical Abstract
  • well as a peptide–tubulysin A conjugate [K4(C(TubA)-βA-),F7,P34]-pNPY – representing a comparable PDC – compared to wildtype pNPY for their binding affinities at the NPY Y1 receptor subtype. While [F7,P34]-pNPY (IC50 = 1.3 nM) showed a comparable binding affinity as pNPY (IC50 = 1.8 nM), the Y1
PDF
Album
Supp Info
Full Research Paper
Published 10 Jan 2019

New standards for collecting and fitting steady state kinetic data

  • Kenneth A. Johnson

Beilstein J. Org. Chem. 2019, 15, 16–29, doi:10.3762/bjoc.15.2

Graphical Abstract
  • quantitative analysis, fulfilling the major goal of their work [1][2]. Estimating the binding affinity for the substrate as KS was an added bonus. These were profound discoveries that laid the foundation for enzymology throughout the 20th century. The Michaelis–Menten equation was originally derived assuming
  • . Moreover, it shows that the Km value represents the balance point between the rate of turnover and the rate of substrate binding. The Km represents substrate binding affinity only in the special case of rapid equilibrium binding. A primary goal of fitting steady state data should be to accurately define
  • binding affinity. The awkwardness is the result of historical precedent. Defining the specificity constant as kcat/Km carries with it the baggage of thinking of the specificity constant as a ratio rather than a single parameter. Logic is influenced by the words we use to describe observations. It actually
PDF
Album
Review
Published 02 Jan 2019

6’-Fluoro[4.3.0]bicyclo nucleic acid: synthesis, biophysical properties and molecular dynamics simulations

  • Sibylle Frei,
  • Andrei Istrate and
  • Christian J. Leumann

Beilstein J. Org. Chem. 2018, 14, 3088–3097, doi:10.3762/bjoc.14.288

Graphical Abstract
  • polarizability of the modified nucleotide, and therefore influences the metabolic stability, the membrane permeability, the RNA- and protein-binding affinity of the AON [25][26][27][28][29]. Over the last almost two decades, fluorinated oligonucleotide analogs like 2’-deoxy-2’-fluoro-RNA (F-RNA) [26][30][31], 2
PDF
Album
Supp Info
Full Research Paper
Published 20 Dec 2018

Protein–protein interactions in bacteria: a promising and challenging avenue towards the discovery of new antibiotics

  • Laura Carro

Beilstein J. Org. Chem. 2018, 14, 2881–2896, doi:10.3762/bjoc.14.267

Graphical Abstract
  • (Figure 3) which displayed a >4-fold increase in its affinity for E. coli SC [63]. Recent evidence suggests that non-steroidal anti-inflammatory drugs (NSAIDs) have antimicrobial activity. Oakley et al. studied the E. coli β-clamp binding affinity of commercially available NSAIDs with the help of a FP
  • phenylalanine benzyl ring, in which two chlorine atoms where incorporated in the benzene ring to achieve P14 (17, Figure 5) with a 15-fold increase of its binding affinity for the sliding clamp and reaching the 10−8 M range (IC50 = 0.077 μM) [65]. Recently, Løbner-Olesen and co-workers screened a library of
PDF
Album
Review
Published 21 Nov 2018

Pd-Catalyzed microwave-assisted synthesis of phosphonated 13α-estrones as potential OATP2B1, 17β-HSD1 and/or STS inhibitors

  • Rebeka Jójárt,
  • Szabolcs Pécsy,
  • György Keglevich,
  • Mihály Szécsi,
  • Réka Rigó,
  • Csilla Özvegy-Laczka,
  • Gábor Kecskeméti and
  • Erzsébet Mernyák

Beilstein J. Org. Chem. 2018, 14, 2838–2845, doi:10.3762/bjoc.14.262

Graphical Abstract
  • ]. Poirier et al. proved that 13α-derivatives of 3,17-estradiols have reduced binding affinity for estrogen receptor alpha and display no uterotropic activity [19]. The conformational change resulting from the inversion at C-13 leads to an epimer unable to bind to its nuclear receptors. We have recently
PDF
Album
Supp Info
Full Research Paper
Published 14 Nov 2018

Novel solid-phase strategy for the synthesis of ligand-targeted fluorescent-labelled chelating peptide conjugates as a theranostic tool for cancer

  • Sagnik Sengupta,
  • Mena Asha Krishnan,
  • Premansh Dudhe,
  • Ramesh B. Reddy,
  • Bishnubasu Giri,
  • Sudeshna Chattopadhyay and
  • Venkatesh Chelvam

Beilstein J. Org. Chem. 2018, 14, 2665–2679, doi:10.3762/bjoc.14.244

Graphical Abstract
  • of the intermediates. The various components that are assembled include the cell surface protein recognition ligand, a peptide spacer for enhanced solubility and binding affinity, a fluorescent tag for tissue staining and a chelating core to tether therapeutic cargos. This goal is smoothly achieved
  • modified by removal of the L-glutamic acid residue to give the pteroic acid moiety (Figure 2). The binding affinity of the modified folate is relatively weaker than folic acid [41]. The targeting ligand, pteroic acid, is covalently coupled to 8-aminocaprylic acid to separate the active binding site of
  • folate protein from the interference of fluorescent cargo attached to lysine and the chelating core as described for 13. Thus our newly designed bioconstructs 13 and 17 have the following four components, (i) a cell surface protein recognition ligand, (ii) a peptidic spacer which enhances the binding
PDF
Album
Supp Info
Full Research Paper
Published 18 Oct 2018

Pathoblockers or antivirulence drugs as a new option for the treatment of bacterial infections

  • Matthew B. Calvert,
  • Varsha R. Jumde and
  • Alexander Titz

Beilstein J. Org. Chem. 2018, 14, 2607–2617, doi:10.3762/bjoc.14.239

Graphical Abstract
  • compound was tested in a whole cell ELISA, it was shown that the apparent binding affinity increases by a factor of 250 versus methyl α-D-mannoside, while the valency only increased by a factor three. It should be noted that the full length FimH adhesin consists of two domains, a lectin and a pilin domain
PDF
Album
Review
Published 11 Oct 2018

Comparative cell biological study of in vitro antitumor and antimetastatic activity on melanoma cells of GnRH-III-containing conjugates modified with short-chain fatty acids

  • Eszter Lajkó,
  • Sarah Spring,
  • Rózsa Hegedüs,
  • Beáta Biri-Kovács,
  • Sven Ingebrandt,
  • Gábor Mező and
  • László Kőhidai

Beilstein J. Org. Chem. 2018, 14, 2495–2509, doi:10.3762/bjoc.14.226

Graphical Abstract
  • (H-Lys(Dau=)-OH)) formed via lysosomal degradation of this type of conjugates had a lower binding affinity to DNA, than the free drug [35]. The two-fold higher intracellular fluorescence intensity of Dau was accompanied by almost two-fold higher cytotoxic activity compared to the conjugates. By
  • than via intracellular mechanisms induced after the internalization of conjugates. Although the conjugates showed an opposite activity on melanoma adhesion (increasing effects) and chemotaxis (decreasing or neutral effects), based on our previous studies about the receptor binding affinity of
PDF
Album
Supp Info
Full Research Paper
Published 26 Sep 2018

Rational design of boron-dipyrromethene (BODIPY) reporter dyes for cucurbit[7]uril

  • Mohammad A. Alnajjar,
  • Jürgen Bartelmeß,
  • Robert Hein,
  • Pichandi Ashokkumar,
  • Mohamed Nilam,
  • Werner M. Nau,
  • Knut Rurack and
  • Andreas Hennig

Beilstein J. Org. Chem. 2018, 14, 1961–1971, doi:10.3762/bjoc.14.171

Graphical Abstract
  • cyclohexylmethylammonium (cyH) cations by displacement titrations (see below) in our mixture of 30% (v/v) ACN/H2O, which gave Ka(Bnz) = 1.4 × 105 M−1 and Ka(cyH) = 1.5 × 107 M−1. This indicated that the binding affinity is lowered 100 to 1000-fold by reducing the hydrophobic effect in presence of 30% acetonitrile as also
PDF
Album
Supp Info
Full Research Paper
Published 30 Jul 2018

Diazirine-functionalized mannosides for photoaffinity labeling: trouble with FimH

  • Femke Beiroth,
  • Tomas Koudelka,
  • Thorsten Overath,
  • Stefan D. Knight,
  • Andreas Tholey and
  • Thisbe K. Lindhorst

Beilstein J. Org. Chem. 2018, 14, 1890–1900, doi:10.3762/bjoc.14.163

Graphical Abstract
  • the following amino acid sequence: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNL-VVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSG-TVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLT-PVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQF-VWNIYANNDVVVPTGGHHHHHH. Docking studies Computer-aided docking studies were performed to evaluate the binding affinity
PDF
Album
Supp Info
Full Research Paper
Published 24 Jul 2018

Synthesis of 9-arylalkynyl- and 9-aryl-substituted benzo[b]quinolizinium derivatives by Palladium-mediated cross-coupling reactions

  • Siva Sankar Murthy Bandaru,
  • Darinka Dzubiel,
  • Heiko Ihmels,
  • Mohebodin Karbasiyoun,
  • Mohamed M. A. Mahmoud and
  • Carola Schulzke

Beilstein J. Org. Chem. 2018, 14, 1871–1884, doi:10.3762/bjoc.14.161

Graphical Abstract
  • pH-sensitive light-up probe. Photometric and fluorimetric titrations of duplex and quadruplex DNA to 9-(arylethynyl)benzo[b]quinolizinium derivatives revealed a significant binding affinity of these compounds towards both DNA forms with binding constants of Kb = 0.2–2.2 × 105 M−1. Keywords: DNA
PDF
Album
Supp Info
Full Research Paper
Published 23 Jul 2018
Other Beilstein-Institut Open Science Activities